Protein Info for Psyr_0860 in Pseudomonas syringae pv. syringae B728a

Annotation: Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details PF02203: TarH" amino acids 19 to 189 (171 residues), 44.5 bits, see alignment E=3.5e-15 PF12729: 4HB_MCP_1" amino acids 22 to 200 (179 residues), 51.1 bits, see alignment E=2.5e-17 PF00672: HAMP" amino acids 230 to 277 (48 residues), 28.6 bits, see alignment 2.9e-10 PF00015: MCPsignal" amino acids 348 to 524 (177 residues), 138 bits, see alignment E=6.1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0860)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY54 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Psyr_0860 Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a)
MKRFLPRFLRRQATTPTLLRRFKITLRLVICFAITSLLMVALGVFCLLQMQAIRTQGEAV
ESGALPSIATADAIAIGLVKLRSETTRLIANADDPGAVINSKINVEQLRNEVEKGFSEYL
ARVQSGTEHDSIVALQDAYKAFMPGLQDQIALIEQNKLDEARTLANTVLSLQGDLMDMQV
QLLRELNTQSAAAAVEAAGASYEQTRIIALSAIGLVLVLTLLLAWRLSVSIIHPVRQALH
IASTIADGDLSEHPIPDGKDETAQLLITLGRMRTNLHSTIDQIYAAATQLSQSVQEMGSI
AEASALNLQLQNTEIEQAAVAVNQMSQAAIEVAGNASNTVTESEASTRAAAQGQEKLSAT
ILSIKALTENVLDSSHQAEGLAERTQSISSILDVIRAIANQTNLLALNAAIEAARAGEAG
RGFAVVADEVRSLAQRTSASTAEIEGLISGVQQSTQQTASSLRHTATQANLTMEQAASTG
EALQVIIQSTATINDRNLLIASAAEQQAQVATEVDRNLSSIRDLSSQTASGAQQTTVASN
ALSMLATDLNLMVQRFVL