Protein Info for Psyr_0851 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0191

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 5 to 26 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF01794: Ferric_reduct" amino acids 44 to 155 (112 residues), 64.5 bits, see alignment E=5e-22

Best Hits

Swiss-Prot: 100% identical to MSRQ_PSEU2: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0851)

MetaCyc: 40% identical to membrane-bound flavocytochrome MsrQ (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY63 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Psyr_0851 Protein of unknown function UPF0191 (Pseudomonas syringae pv. syringae B728a)
MRYPFLRLAVFLAACIAPVWWLYQAWIFALGPDPGKVLVENFGVATLVMLLITLSMTPLQ
RLTGWSGWIVVRRQLGLWCFAYALLHLSMYALFILGLDWGQLGVELVKRPYIIVGALALL
GLLALAVTSNRYSQRRLGARWKKLHRIIYVILGLGLLHMFWIVRADLKEWALYAGIGAFL
LLLRIPVFARRIPRLGGAAKARSVKVQNNG