Protein Info for Psyr_0839 in Pseudomonas syringae pv. syringae B728a

Annotation: Deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR00126: deoxyribose-phosphate aldolase" amino acids 18 to 228 (211 residues), 154.5 bits, see alignment E=1.3e-49 PF01791: DeoC" amino acids 27 to 211 (185 residues), 73 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 44% identical to DEOC_SHIF8: Deoxyribose-phosphate aldolase (deoC) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to psb:Psyr_0839)

MetaCyc: 44% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY75 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Psyr_0839 Deoxyribose-phosphate aldolase (Pseudomonas syringae pv. syringae B728a)
MKEMTADDERLARQVIGLLELFALNTDDTEQRIVGICRRACTPVGPVAAVSVQQRFVCLA
RTTLDRLQARHIKVVAVVNFPHGSSNVQSVIAQVRAALMAGADEIDVVYPFRALLGGDRQ
PGLAMISACSALCAGQVMLTATLETGDLRDSQMILDACRDAIVSGADFIKTSTGKAARHV
TPQAARIMLESIADVGGQVGLKVAGGIRTFDEARVYMALVRARFGLQWINAGRFRLGGSS
VLDDLLARLGLLESHGGGDGF