Protein Info for Psyr_0829 in Pseudomonas syringae pv. syringae B728a

Annotation: 7, 8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase" amino acids 11 to 139 (129 residues), 140.9 bits, see alignment E=1.3e-45 PF01288: HPPK" amino acids 12 to 139 (128 residues), 128.9 bits, see alignment E=6.2e-42

Best Hits

Swiss-Prot: 70% identical to HPPK_PSEAE: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 100% identity to psb:Psyr_0829)

MetaCyc: 51% identical to 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (Escherichia coli K-12 substr. MG1655)
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase. [EC: 2.7.6.3]

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.3

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY85 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Psyr_0829 7, 8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK (Pseudomonas syringae pv. syringae B728a)
MNEPLLATERVYIGLGSNLADPAEQLRSALKAIAQLPDCQLSGVSSFYISDSLLPGQPRF
TNAVAAIDTALAPLALLDALQAIELDQGRERHERWGPRTLDLDILLFGDHLIDEPRLKVP
HYHMQARAFVLYPLAELAPGLTLADGRPLNRLLDECPFTGLERLPAEA