Protein Info for Psyr_0810 in Pseudomonas syringae pv. syringae B728a

Annotation: Tellurite resistance TerB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF05099: TerB" amino acids 30 to 148 (119 residues), 84.8 bits, see alignment E=2.8e-28

Best Hits

KEGG orthology group: K05793, tellurite resistance protein TerB (inferred from 98% identity to pst:PSPTO_0942)

Predicted SEED Role

"Tellurite resistance protein TerB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYA4 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Psyr_0810 Tellurite resistance TerB (Pseudomonas syringae pv. syringae B728a)
MLDWLKTNATAARDKLASEVSKFKNREFMEAVVSGCALVSAADGDISSSEKQKMAGFIQN
SQELKVFDMKDVIQGFQEACSKFEFDFEIGRAEALKTIGKIKKKEDAARLLVRVCCAIGG
ADGSFDEKEREVCRTICRELGLNPSDFDL