Protein Info for Psyr_0786 in Pseudomonas syringae pv. syringae B728a

Annotation: CheW-like protein:ATP-binding region, ATPase-like:Signal transducing histidine kinase, homodimeric:Hpt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 transmembrane" amino acids 664 to 683 (20 residues), see Phobius details PF01627: Hpt" amino acids 10 to 94 (85 residues), 60.2 bits, see alignment E=3.8e-20 PF02895: H-kinase_dim" amino acids 310 to 343 (34 residues), 35.1 bits, see alignment (E = 3.1e-12) PF02518: HATPase_c" amino acids 416 to 553 (138 residues), 61.2 bits, see alignment E=2.5e-20 PF01584: CheW" amino acids 559 to 685 (127 residues), 104.6 bits, see alignment E=6.7e-34

Best Hits

KEGG orthology group: K03407, two-component system, chemotaxis family, sensor kinase CheA [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_0786)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYC8 at UniProt or InterPro

Protein Sequence (705 amino acids)

>Psyr_0786 CheW-like protein:ATP-binding region, ATPase-like:Signal transducing histidine kinase, homodimeric:Hpt (Pseudomonas syringae pv. syringae B728a)
MSINLDQAQQTFIVEARELLQAMEESLLQLESEPGDLDAIGAVFRAAHTIKGSAGLFGLT
PIVSFTHIVEDVLDRLREGSVSVNAELIAVLLKSGDHMLELIDVVASRGEQLQQPALERE
AALRQALQVFQAPASASAADIASAQVVSDDEQSADVLWHISLRFGVDVFRNGMDPLSFLR
YLNTLGQMVQVTTLTDSIPTVEAWDPESCHLGFEIDFRSAAGHAAINEVFDFVREDCAVE
ITPLDETPDHVEPTGTELVSQPEHSPVVASGELLGDQRAVPRTPATATATATAVERPSSG
SEQKNKDGRYVRVNADKLDELINLVGELVIASAGASLLAKSCDNDPLQEASSTVSGLVEQ
ILDGALHLRMIPIGDTFNRFRRVVRDVSQELGKDIDLIINGAETELDKTVVEKIGDPLMH
LLRNSMDHGIESAEARRAAGKPAKGHLSLNAYHDSGSIVIEIADDGAGLNRERILDKAQQ
RGLVAAGASLTDQEIYNLIFEPGFSTAEAVTNLSGRGVGMDVVKRNITLLRGTVDLDSQP
GQGTIVRIRLPLTLAIINGFLVGIDQSTYVIPLDMVQECIELDEHNRQLTRDSGYLDLRG
EVLPLVYLRDHFNHEGPAARRQNVVVVRYAEHKAGLVVDDLLGEFQTVIKPLGKLFGALR
GISGSTILGSGAVALILDIPALLNQIVHMEARSTQAPQFLLPTSR