Protein Info for Psyr_0783 in Pseudomonas syringae pv. syringae B728a

Annotation: MCP methyltransferase, CheR-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF03705: CheR_N" amino acids 11 to 61 (51 residues), 45.5 bits, see alignment 1.2e-15 PF01739: CheR" amino acids 77 to 262 (186 residues), 190 bits, see alignment E=8e-60

Best Hits

Swiss-Prot: 42% identical to CHER2_PSEAE: Chemotaxis protein methyltransferase 2 (cheR2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to psb:Psyr_0783)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYD1 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psyr_0783 MCP methyltransferase, CheR-type (Pseudomonas syringae pv. syringae B728a)
MPDTASLTDREFGQFQNWLYNAAGIKLTLAKKALVAGRLFKRLKHYELDSYGEYFKLIMN
DQRNGELQVALDLLTTNETYFFREPKHFDFLRQQVLPKVTHGKMFRIWSAASSSGEEPYS
LAMTLAEQLGTAPWEVVGSDISTRVLSKARSGHYPMERTETLPQPLLFKYCLKGTGRQEG
TFLIDKSLRSRVSFVQVNLNDTLPDLGEFDVIFLRNVMIYFDQETKSKVVARLIPRLKPG
GYFIISHSESLNGVNDMLKMVSPSIYRKP