Protein Info for Psyr_0757 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00356: LacI" amino acids 4 to 48 (45 residues), 62.1 bits, see alignment 5e-21 PF00532: Peripla_BP_1" amino acids 69 to 313 (245 residues), 142.5 bits, see alignment E=3e-45 PF13377: Peripla_BP_3" amino acids 171 to 329 (159 residues), 72.6 bits, see alignment E=6.5e-24

Best Hits

Swiss-Prot: 47% identical to CSCR_SHIFL: Sucrose operon repressor (cscR) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0757)

Predicted SEED Role

"Sucrose specific transcriptional regulator CscR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYF7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psyr_0757 transcriptional regulator, LacI family (Pseudomonas syringae pv. syringae B728a)
MTSVKDVAKLAGVSLMTVSRALNDPGKLSPETYQRVRNAIDELQFVPSLSARRIRGDNLQ
TRTIGVFALDTATTPFAVELLLSIEQTAQQAGWNVFILNLLSNPPTDQNIDLMLSHRPDG
LIFSAMGLRKVSIPQRLKSKPLVLANCVADDSSLVSYVPDDEMGQYRALHHAFSKGYRRP
LFINLPKQSLAWEIRQAGMQRACEAFGLARDELLQYNLSEHDAYWETAAILARHMLDGRP
QFDILICGNDRIAFCAYQLLLGQGLKIPGDVAVLGYDNMIGIAELFIPALTTVQLPYYEI
GRNAARHLIDSIEVSGSQPVDCPLVVRESL