Protein Info for Psyr_0722 in Pseudomonas syringae pv. syringae B728a

Annotation: Two-component response regulator PilR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 105 bits, see alignment E=6.2e-34 PF00158: Sigma54_activat" amino acids 136 to 301 (166 residues), 225.9 bits, see alignment E=6.5e-71 PF14532: Sigma54_activ_2" amino acids 136 to 306 (171 residues), 78 bits, see alignment E=2.2e-25 PF25601: AAA_lid_14" amino acids 307 to 383 (77 residues), 78 bits, see alignment E=9.9e-26 PF02954: HTH_8" amino acids 402 to 442 (41 residues), 56 bits, see alignment 6.7e-19

Best Hits

Swiss-Prot: 77% identical to PILR_PSEAE: Type 4 fimbriae expression regulatory protein PilR (pilR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 100% identity to psb:Psyr_0722)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYI2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_0722 Two-component response regulator PilR (Pseudomonas syringae pv. syringae B728a)
MSQRQKILIVDDEPDIRELLEITLGRMKLDTRSARNVAEAHDWLAREPFDMCLTDMRLPD
GNGLELVQHIQHGYPHVPVAMITAHGNLDTAIHALKAGAFDFVTKPVDLGRLRELVNSAL
SLPGAQPTRSIDNRLLGDSLAMRTLRSQIGKLARSQAPIYISGESGSGKELVARLIHEQG
PRIDKPFIPVNCGAIPSELMESEFFGHRKGSFSGAHEDKPGLFQAAHTGTLFLDEVADLP
LAMQVKLLRAIQEKSIRSVGGQQEQIVDVRILCATHKNLNAEVAAGRFRQDLYYRLNVIE
VRVPSLRERREDIDQLAASVLKRLAGNGAQPVARLNAQALETLKSYRFPGNVRELENMLE
RAYTLCENDEIHASDLRLTESASPQENDGPSLADIDNLEDYLESVERQLILQALEETRWN
RTAAAERLSLSFRSLRYRLKKLGLD