Protein Info for Psyr_0706 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 186 to 213 (28 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 326 (322 residues), 101.9 bits, see alignment E=1.9e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0706)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYJ8 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Psyr_0706 Acyltransferase 3 (Pseudomonas syringae pv. syringae B728a)
MRMISLQYLRGFAALLVVVGHNSFFLGGDWIDHIPALLGVDIFFIVSGFIMTLITYQSPE
RPISFVIRRFFRIWPAFFVVWLLSYLFVYPEKPLDQMVCSLYFCLQDYSLVAPSFGFSAL
GPPWTLTYEVVFYLVFTISMSISYRYRSYVCALVFLVSSVGFQLYYNGHFDFSSQASPDI
VVVHVWQVWIKIISNTITFEFIAGMMLAELMLANRLPDLSLSGRRLMQLALLLAIISACL
LGWQDFGLRGGFWLALIIVSSVVMLGYRAEVKGNRLLIFLGDISYSLYLVHYSLMMFLIK
IIPGNAPMVEKAGVFILSIAASIVLAFFMFEWVEKPFIRVGKKVASVLSAGQK