Protein Info for Psyr_0705 in Pseudomonas syringae pv. syringae B728a

Annotation: CreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05981: CreA" amino acids 23 to 150 (128 residues), 196.4 bits, see alignment E=8.5e-63

Best Hits

Swiss-Prot: 62% identical to CREA_ECOL6: Protein CreA (creA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05805, CreA protein (inferred from 99% identity to psp:PSPPH_0717)

Predicted SEED Role

"Conserved uncharacterized protein CreA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYJ9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psyr_0705 CreA (Pseudomonas syringae pv. syringae B728a)
MRFMKGLLAAALLVPVLVSAEEIGQVSTVFKMVGPNDRIVVEAFDDPKVDGVTCYLSRAK
TGGVRGGLGLAEDRAEASIACRQVGPIRFKETLKDGDEVFKERTSLVFKTMQVVRFFDKK
RNALVYLVYSDRVIEGSPQNAVTAIPILPWTTAPAP