Protein Info for Psyr_0672 in Pseudomonas syringae pv. syringae B728a

Annotation: nucleoside ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 199 to 216 (18 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 282 to 311 (30 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 338 (279 residues), 176.9 bits, see alignment E=2.3e-56

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to psb:Psyr_0672)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYN0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Psyr_0672 nucleoside ABC transporter membrane protein (Pseudomonas syringae pv. syringae B728a)
MLLSLEPRGQQSRAMLWCSPLLAAVLTLVCGSLLFIGLGLNPWVTLHTLLIAPVSDWYGL
SELMVKTLPILLCALGLAVAYQARIWNIGAEGQLLLGALAGSAVAVNIIEMESRWALVMV
LLAGTLAGAAWAGVTAWLRTHFNANEILTSIMLNYIALNLLLYFVHGPLKDPAGMNFPES
ATFGDASRLPLLMEDGRAHIGVYFALLALVAVWVLLQRSFVGFQIKVLGLDKRAAGFVGF
REKRLVWLALLISGALAGLAGVSEVTGPIGQLVPQVSPGYGYAAITVAFLGRLNPIGILF
SSLLIALLYLGGESAQMTLNLPLAITQLFQGMMLFFLLACDVLILYRPRLKLHWAKRQMT
PVTGAA