Protein Info for Psyr_0653 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 184.8 bits, see alignment E=3.1e-59 PF13411: MerR_1" amino acids 1 to 67 (67 residues), 61.9 bits, see alignment E=7.4e-21 PF00376: MerR" amino acids 2 to 39 (38 residues), 56.3 bits, see alignment E=3.2e-19 PF09278: MerR-DNA-bind" amino acids 44 to 108 (65 residues), 81.9 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 81% identical to Y4778_PSEAE: Uncharacterized HTH-type transcriptional regulator PA4778 (PA4778) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0653)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYP9 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psyr_0653 transcriptional regulator, MerR family (Pseudomonas syringae pv. syringae B728a)
MNIGQAAKNSGLSAKMIRYYESIGLLQAAHRSESGYRLYSADDLHTLAFIKRSRDLGFSL
EEVGKLLTLWQDRQRASADVKALARQHIAELNRKIDELASLRDTLQELVEHCHGDDRPDC
PILKDLASGRCC