Protein Info for Psyr_0637 in Pseudomonas syringae pv. syringae B728a

Annotation: LrgB-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 151 to 179 (29 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details PF04172: LrgB" amino acids 23 to 235 (213 residues), 247.5 bits, see alignment E=4.8e-78

Best Hits

Swiss-Prot: 38% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0637)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYR5 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psyr_0637 LrgB-like protein (Pseudomonas syringae pv. syringae B728a)
MSLDWHGAWLSVIHHPLFGIAITLSAYQLAMAAYERTRWLFLQPVLVSMVVVIGIVLFCD
LEYTEYRKSTEILGTLLGPATVALAVPLYLNMRRIRQLFWPVLTTLVIGGVFATGLCVGF
GVLFGADHMILMTMAPKSVTSPIAMLVAEQIGGVAALAAVFVLITGVFGAIFGPGLLSLI
GVDNPAARGMALGLTAHAVGTSVALQEGEETGAFAALAMSLMGVATALFLPLAMSLAI