Protein Info for Psyr_0604 in Pseudomonas syringae pv. syringae B728a

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 18 to 289 (272 residues), 400 bits, E=1.2e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 22 to 626 (605 residues), 876.1 bits, E=6.9e-268
• PF00676: E1_dh
  • amino acids 130 to 193 (64 residues), 24.2 bits, E=4e-09
• PF02779: Transket_pyr
  • amino acids 327 to 486 (160 residues), 149 bits, E=2.9e-47
• PF02780: Transketolase_C
  • amino acids 502 to 618 (117 residues), 98.3 bits, E=8.1e-32

Best Hits

Swiss-Prot: 100% identical to DXS_PSEU2: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to psb:Psyr_0604)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• isoprene biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See Q4ZYU8 at UniProt or InterPro

Protein Sequence (630 amino acids)

>Psyr_0604 1-deoxy-D-xylulose-5-phosphate synthase (Pseudomonas syringae pv. syringae B728a)
MPTTFKEIPRERPVTPLLDRADTPHGLRRLGEAELETLADELRLELLYSVGQTGGHFGAG
LGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRARMSTLRQKEGVAAFPRRSES
EYDTFGVGHSSTSISAALGMAIASRLQGSERKSIAVIGDGALTAGMAFEALNHAPEVAAD
MLVILNDNDMSISRNVGGLSNYLAKILSSRTYSSMREGSKKVLSRLPGAWEIARRTEEYA
KGMLVPGTLFEELGWNYIGPIDGHDLPTLIATLRNMRDLKGPQFLHVVTKKGKGFAPAEV
DPIGYHAITKLEPLNAPAAQKKISAPKYSGVFGQWICDMADADARLVGITPAMKEGSDLV
AFSERFPERYFDVAIAEQHAVTLAAGMACEGSKPVVAIYSTFLQRGYDQLIHDVAVQNLD
VLFAIDRAGLVGEDGPTHAGSFDLSYLRCIPGMLVMTPSDENELRKLLSTGYLHTGPAAV
RYPRGTGPNAVIEASLDPLEIGKGVVRRQGQGVAILAFGVQLAEALVVAEKLDATVIDMR
FVKPLDEALVSEAAANHELLVTLEENAVMGGAGAAVSEFLARANILKSVLHLGLPDVYVE
HAKPAQMLTECGLDAQGIEAAINERLALIG