Protein Info for Psyr_0595 in Pseudomonas syringae pv. syringae B728a

Annotation: Nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 10 to 398 (389 residues), 490.6 bits, E=1.9e-151
• PF17767: NAPRTase_N
  • amino acids 15 to 132 (118 residues), 121.2 bits, E=3.6e-39
• PF04095: NAPRTase
  • amino acids 172 to 398 (227 residues), 291.2 bits, E=7.3e-91

Best Hits

Swiss-Prot: 100% identical to PNCB_PSEU2: Nicotinate phosphoribosyltransferase (pncB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to psb:Psyr_0595)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

See Q4ZYV7 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Psyr_0595 Nicotinate phosphoribosyltransferase (Pseudomonas syringae pv. syringae B728a)
MSESAFSNRIVQSLLDTDFYKLTMMQAVLHNYPNVDVEWEFRCRNGEDLRPYLDEIKHQI
ELLCELSLSPEHLAFLERITFIKPDFLRFLGLFRFNTRYVKTTIENDELCIRLHGPWLHV
ILFEVPLLAIVSEVRNRHRYPDTLLSQARDRLYDKFEWLTTHATTDELAELKVADFGTRR
RFSYRVQEEMLGVLKNDFPGQFVGTSNVHLARQLDLKPLGTMAHEWIMAHQQLGPRLIDS
QIAALDCWVREYRGLLGIALTDCITTDAFLNDFDLYFAKLFDGLRHDSGDPVKWAEKCIS
HYQKLGIDPMSKTLVFSDGLNLPKALDIFRALRGRINVSFGIGTNLTADIPGIAPMNMVL
KMTACAGQAVAKISDEPGKTQCKDPNFVAYLRHVFKVPDLPSPEKPA