Protein Info for Psyr_0583 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 148 to 173 (26 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 248 to 274 (27 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0583)

Predicted SEED Role

"FIG003573: hypothetical protein" in subsystem CBSS-262719.3.peg.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYW9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Psyr_0583 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MRALAEFIMRGRMQATLVVAGCAALPLLFWLSAAAGCLVLLRRGFSDAVGVLAWALLPAL
VWWYFGEPRTAMVLAGSLSLAMVLRASESWVRVLLVSVALGVVYAVILGTVFREPLEAMS
QELQKHLPTMLAGLYEQLNVEERARLGALIAPVLNGLIAAVLQIVSVLCLILGRYWQAML
YNPGGFGREFRAVKLPLVPALVLVVCMLVGPNFGPQIAMLTPLCSVPLVFAGLALIHGLV
AEKRLSRFWLVGMYITLLVFMQLIYPLLVVIAIVDSLIDFRGRRSSKDSGNGPANGEG