Protein Info for Psyr_0542 in Pseudomonas syringae pv. syringae B728a

Annotation: Three-deoxy-D-manno-octulosonic-acid transferase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 270 to 287 (18 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details PF04413: Glycos_transf_N" amino acids 5 to 167 (163 residues), 223.3 bits, see alignment E=8.6e-71

Best Hits

Swiss-Prot: 50% identical to KDTA_HAEIN: 3-deoxy-D-manno-octulosonic acid transferase (waaA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02527, 3-deoxy-D-manno-octulosonic-acid transferase [EC: 2.-.-.-] (inferred from 100% identity to psb:Psyr_0542)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ10 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Psyr_0542 Three-deoxy-D-manno-octulosonic-acid transferase, N-terminal (Pseudomonas syringae pv. syringae B728a)
MQRGGIWVHAVSVGESIAAAPMIRSLLVQYPQLPITVTCMTPTGSERIKALFASEPRIQH
CYLPYDLPWAAARFLDQVQPRLGIIMETELWPNHIHQCFLRGIPVVLANARLSERSARGY
ARFAGLTRPMLAEMAWFAVQTEAEAKRFRDLGARPECVAVTGSIKFDLSIDPQLLQRAAQ
QREQWQTTQRPVWIAASTHAGEDESVLAAHRTLLTSHPDALLILVPRHPERFDSVHALCQ
QQGFATVRRSTGQAVTADVSVLMGDTMGELLFLYALADIAFVGGSLVPNGGHNLLEPAAL
AMPVLSGPHLFNFLEIAAMLRKAGALQEVNDAAALATAVQGLFDQPQQARNMADAGLAVM
KANQGALQRLLDGIGRLMGKR