Protein Info for Psyr_0534 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 40 to 56 (17 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 364 to 380 (17 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0534)

Predicted SEED Role

"Oligosaccharide repeat unit polymerase Wzy; O-antigen ligase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ18 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Psyr_0534 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MSVDPIRVPGSKVQQYFTAAIVIFLLSFILNPSAKITNNLFYAFTALPGLFFLIRYRAAG
VFAKPLGIAWAVFMACFLVPALQAQEFQYYKHIIYVSLFVFVVAGITDNGFFRRGVFVRS
MFWVICLYILLSSIHSWVTGQFEFGQRVAILPGRMENVIYASAWLVCSLALAMPLWARER
RWVEAVCAVLVTLVISAFVVQTRTALVGCAVLFAVCTAYSLYRFPLRTIVALLALGVVAA
AAFWFVKDEQWVALLTARGDSYRIELFEIMTGEWRRCGWMLGCGVDFYTTQTLTGGIPIQ
HPHNIFVSLGLYTGAASLVMFLVVMAMTLWDALRNGDAWGLYLVCALVMLNFDGGQLVGN
PDELWVLVLLPATMVLGRVVQTHRLRQQQ