Protein Info for Psyr_0512 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF13527: Acetyltransf_9" amino acids 15 to 132 (118 residues), 27.5 bits, see alignment E=5.4e-10 PF00583: Acetyltransf_1" amino acids 32 to 130 (99 residues), 41.3 bits, see alignment E=3.4e-14 PF13673: Acetyltransf_10" amino acids 46 to 150 (105 residues), 53.5 bits, see alignment E=4.8e-18 PF13508: Acetyltransf_7" amino acids 50 to 131 (82 residues), 37.5 bits, see alignment E=5.2e-13

Best Hits

Swiss-Prot: 53% identical to ELAA_ECOLI: Protein ElaA (elaA) from Escherichia coli (strain K12)

KEGG orthology group: K02348, ElaA protein (inferred from 99% identity to psp:PSPPH_0502)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ40 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psyr_0512 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MSIKWICKHHTELSIEQLYAVLQLRAEVFVVEQQCVYLDVDGQDLMGDTCHLMAWQEDKL
VAYLRLLDPIQQGGDVTIGRVVTAPSIRSRGIGHELMEQALENAERKWPDQPIYLSAQAH
LQGYYSRYGFNPVGEVYLEDDIPHIGMRRDLD