Protein Info for Psyr_0487 in Pseudomonas syringae pv. syringae B728a

Annotation: glutathione synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR01380: glutathione synthase" amino acids 4 to 313 (310 residues), 451.2 bits, see alignment E=8.1e-140 PF02951: GSH-S_N" amino acids 4 to 121 (118 residues), 159.4 bits, see alignment E=5.5e-51 PF02955: GSH-S_ATP" amino acids 125 to 297 (173 residues), 268.6 bits, see alignment E=2.8e-84 PF08443: RimK" amino acids 137 to 310 (174 residues), 40.1 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 98% identical to GSHB_PSESM: Glutathione synthetase (gshB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 100% identity to psb:Psyr_0487)

MetaCyc: 68% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ65 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psyr_0487 glutathione synthase (Pseudomonas syringae pv. syringae B728a)
MSVRLGIVMDPIERISYKKDSSLAMLLAAQERGWSLFYMEQKDLYQNAGQARARMKPLKV
FADPAKWFEFEAEVDAGLDDLDVILMRKDPPFDMEFVYATYLLEQAERAGVLVVNKPQSL
RDCNEKLFATLFPQCTPPTLVSRRADIIREFAEQHGDVILKPLDGMGGASIFRHRAGDPN
LSVILETLTAHGTQQIMAQGYLPAIKDGDKRILMVDGEPVPYCLARIPAAGETRGNLAAG
GRGEARPLSDKDRWIAEQIGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT
NIGGLLMDAIEKKLQARKG