Protein Info for Psyr_0429 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 257 to 276 (20 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 376 to 402 (27 residues), see Phobius details amino acids 423 to 447 (25 residues), see Phobius details amino acids 647 to 666 (20 residues), see Phobius details amino acids 673 to 691 (19 residues), see Phobius details amino acids 697 to 716 (20 residues), see Phobius details amino acids 724 to 746 (23 residues), see Phobius details amino acids 753 to 773 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0429)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZC3 at UniProt or InterPro

Protein Sequence (791 amino acids)

>Psyr_0429 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MRSVMTSKTERLLPRLFLLILAGVLALAGWQWHDRSPLSANLMELVPGTDNDELVVSAEK
RMQEPLNREMLVLVGHSDRQKAVELARNLAEQWQSTGLFEKVQWSLQADLPALRTQLLQG
RIAMLPTADRTLLIDDPKTFIEQRVQTLFDPFAGFSLVPGQDDWLGLTGRIQNGLPKQGS
VEADLASGALVASTEGKSWVLLRSRTRTDAFDMHLPGQVADLLAQARVQASQAGGQLLAA
SGLLYAADGQKQASREITWVGGGATVGILLLLLLAFRRWSVLLAFVPVVVGMLFGAVACV
AIFGSMHVMTLVLGSSLIGVAVDYPQHYLSKSWSLKPWRSWPALRLTLPGLSLSLITSCI
GYLALAWTPFPALTQIAVFSAAGLIGAYLTAVCLLPALLANVEISPAQWPLKLAQLMLDC
RAALLLRISTPILLVLLLAFCGGGLWHLTTKNDIRQWVAAPQALTDEAQAIARITGYQPT
SQFFLVRGKDQQQLLDRQSELTQRLDQLVSMDKLQGYMALNQLLDSPAEQQATRDALGKL
PQYWAPLVQLGVPASALKAELAQLQALPTQDVDQALQGPLSEPWRTLWLGPTRDDNGDQG
VASIVSLRGMNSMALLRVQAIGLEGVQLVDRLGELNEVFAHTQISAAELKLASCVLIVLL
LITPFGFGGALRIVALPLLAALCSLASLGWLGQPLTLFSLFGLLLVTAISVDYAILMREQ
IGGAAVSLLGTLLAALTTWLSFGLLAVSSTPAISNFGLSVSLGLAFSFLLAPWASPRKAL
HSPATTEGQHA