Protein Info for Psyr_0410 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 270 to 289 (20 residues), see Phobius details PF13604: AAA_30" amino acids 43 to 151 (109 residues), 27 bits, see alignment E=5.2e-10 PF13401: AAA_22" amino acids 48 to 171 (124 residues), 53.2 bits, see alignment E=6e-18 PF05036: SPOR" amino acids 454 to 527 (74 residues), 48.2 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K03112, DamX protein (inferred from 100% identity to psb:Psyr_0410)

Predicted SEED Role

"DamX, an inner membrane protein involved in bile resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZE2 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Psyr_0410 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MTSLHADEAFLGHYQLSHDPFAARVPGFKFFPAQRKPVLGQLHHLARYSQLLLAVTGPQG
SGKTLLRQALVASTNKQSVQSVVISARGAGDAAGVLQQVAQALSVAQAEMQSILSQVVQL
GLTGQEVYLLVDDAEQLGDSALEALLGLAAGTPEGRPHVFLFGEPSLLDRLDQMCADLQG
DVEGERFHVIELQPYTEEETREYLAQRLEGAGQGIALFTADQITDIHEQSDGWPGAINQV
ARDSMIEAMIASRSAVKRPSVGFKMPKKHVLALGAVVIVAVAAAVLIPGRGDKTGTPANA
PASAQAQLPLGEGKPTAQQSNNGSPAIEFAGNSQPMPLPMNGNQPVMRGPLAEAAGSSDS
DEDAVPTGSPAQPPTVTTTAPPAGVPAGQAAAQTPRSSIPAPTPAPAPAAKPAPAQTQVA
TAKPAPAPAAKPAEKPAAAAAKPAAGGSWYSSQAPGHYVVQILGTSSEATAQAYVAEQGG
EYRYFKKTLQGKPLYVVTYGNFPDRAAALAAIKVLPAKVQAGKPWPRTVASVQQELGATR