Protein Info for Psyr_0366 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR02018: histidine utilization repressor" amino acids 44 to 272 (229 residues), 357.8 bits, see alignment E=1.1e-111 PF00392: GntR" amino acids 45 to 108 (64 residues), 68.7 bits, see alignment E=2.7e-23 PF07702: UTRA" amino acids 129 to 266 (138 residues), 127.9 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 86% identical to HUTC_PSEPU: Histidine utilization repressor (hutC) from Pseudomonas putida

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 100% identity to psb:Psyr_0366)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZI4 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psyr_0366 transcriptional regulator, GntR family (Pseudomonas syringae pv. syringae B728a)
MVSVSALQRLNALENTVSNNKDSHVSTPPAASSLAAQMGESPAPLYARVKQMIALQIQNG
TWPPHHRVPSESELVTQLGFSRMTINRALRELTAEGLLVRMQGVGTFVAEPKSQSALFEV
HNIADEIAARGHRHTCKVMVLKEEAAGSERALALDMREGQRVFHSLIVHYENDIPVQIED
RFVNAQVAPDYLRQDFTLQTPYAYLSQVAPLTEGEHVVEAILAEADECRLLQIEAGEPCL
LIRRRTWSGRQPVTAARLIHPGSRHRLEGRFTK