Protein Info for Psyr_0335 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 314 (306 residues), 60.1 bits, see alignment E=9.3e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0335)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZL5 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Psyr_0335 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MRKDYLAFFISLFLSRLADQILLFIVPLVVFQTTNSASWAGLAFFVESLPRFLAFPLCGA
LCDKYPPVKILHISQIYRASLCVLAMVLYAIFGGIGWLVVLSALCGVLTTQGIMAREVLM
PYIFQHYSYTRTLSYSQIADQSGLVLGPLVAALMLEVWAWHWVVLLTAGLFLLADLSMLA
WQRLSRITLEVFEQHQDIWLQPLRIAFGHIRSLAELKKIITLAVGVNLIVGVTLATSAAM
VIGEYSAGKDSYAGLQAAGAVTTIVILFFLARVALPMRVLGGVGFSMIATGAFISALSPN
LIGYALGFLLIVGFDKMFNVYMRTLRQRVIPPQDFGKTVGVITLLNNLSQPLAGLLVALL
AAPLGIRQVILMLAMLTSVIGAGALWWFAKARSPFPTRIVEADREAGK