Protein Info for Psyr_0320 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0149

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF03695: UPF0149" amino acids 10 to 178 (169 residues), 129.9 bits, see alignment E=6.3e-42

Best Hits

Swiss-Prot: 95% identical to Y5224_PSESM: UPF0149 protein PSPTO_5224 (PSPTO_5224) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K09895, hypothetical protein (inferred from 100% identity to psb:Psyr_0320)

Predicted SEED Role

"FIG001590: Putative conserved exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZN0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psyr_0320 Protein of unknown function UPF0149 (Pseudomonas syringae pv. syringae B728a)
MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDSEGWFADASMLLETELLE
TEPQENIRAALVGLQEMVKGELTGDDMTVVLLLPGDDEPLTERAAALGQWCQGFLAGFGL
SIGDKVLGSEAKAVLEDLAAIAQVQDALEESEDGETDYMEVMEYMRVAPLLLFTEFNEPS
APQPKPSLH