Protein Info for Psyr_0304 in Pseudomonas syringae pv. syringae B728a

Annotation: ChaC-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04752: ChaC
  • amino acids 51 to 212 (162 residues), 108.7 bits, E=1.8e-35

Best Hits

Swiss-Prot: 39% identical to CHAC_ECOLI: Glutathione-specific gamma-glutamylcyclotransferase (chaC) from Escherichia coli (strain K12)

KEGG orthology group: K07232, cation transport protein ChaC (inferred from 100% identity to psb:Psyr_0304)

MetaCyc: 39% identical to glutathione-specific gamma-glutamylcyclotransferase (Escherichia coli K-12 substr. MG1655)
RXN-19024 [EC: 4.3.2.7]

Predicted SEED Role

"ChaC-related protein"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.7

Sequence Analysis Tools

See Q4ZZP5 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_0304 ChaC-like protein (Pseudomonas syringae pv. syringae B728a)
MENPINELAAAVHDGLGLTYPPVIDMGPQLTREQLLASMNATMRRHKGGPVWLFAYGSLI
WRPECTAVESQRARVHGYHRGLYLWSHEHRGTPEVPGLVFGLDRGGSCTGFAYRLPDECL
EKSLLALWEREMPYPSYRPHWLNCRLEDGRKVQALGFVLERHLPSYAGNLPDSVLSQVLA
SARGRYGTTREYVEQTAKALRSHAMPDLNLEARLKRCKSETA