Protein Info for Psyr_0200 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 253 to 273 (21 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details PF04073: tRNA_edit" amino acids 28 to 139 (112 residues), 45.5 bits, see alignment E=8e-16 PF08668: HDOD" amino acids 194 to 394 (201 residues), 153.6 bits, see alignment E=4.9e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0200)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZZ9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Psyr_0200 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MTEVAHVNDPHHAPVVIRQLLEKLAISYNEVVDEKNLPPARKVQAVLVEDAVGALLILFP
QSQLLDLSRITELTGRQLTAVPHERLARMLTKHNLRVLPGLPALTSSPCLYDERLLQEPT
LLVGSGEPGVLLEISSEDFKGMLSKASAAHFGQSVAAIRPNLDRPDDDPAEITQAMHAFT
ARRIQQRLEATLEIPPLAGTAQKIIKLRVDPDATIDDITGVVETDPALAAQVVSWAASPY
YASTGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKDQPQQTTPYWQQSIYTAAVI
EGLTRAIPRASRPEGGLSYLAGLLHNFGYLLLAHVFPPHFTLICRQLEVNPHLHHSFIEQ
HLLGISREQIGAWLMRYWDMPDELAIALRFQHDPHYKGEHHVYANLVYLAVRLLRANGIG
SGPEQDIPDELFERLGLTREKANESVKKVLEAEVLLRELASQFSK