Protein Info for Psyr_0186 in Pseudomonas syringae pv. syringae B728a

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3:HAD-superfamily hydrolase, subfamily IA, variant 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00702: Hydrolase" amino acids 2 to 193 (192 residues), 89.8 bits, see alignment E=4.6e-29 PF13419: HAD_2" amino acids 99 to 198 (100 residues), 65.6 bits, see alignment E=9.8e-22 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 103 to 199 (97 residues), 39.8 bits, see alignment E=5.3e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 107 to 193 (87 residues), 42.6 bits, see alignment E=8.5e-15 PF13242: Hydrolase_like" amino acids 153 to 200 (48 residues), 39.4 bits, see alignment 6.9e-14

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to psb:Psyr_0186)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500B3 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Psyr_0186 HAD-superfamily hydrolase, subfamily IA, variant 3:HAD-superfamily hydrolase, subfamily IA, variant 1 (Pseudomonas syringae pv. syringae B728a)
MIKLVTFDLDDTLWDTAPAIAGAEVTLRDWLGEHAPRLGAVPVEHLWEIRSRLVAEDPSF
KHRISALRRRVLFHALEDAGYDPDEAQDLADRGFEVFLQGRHQVQIFPEVQPMLEILAKT
FTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFVEALRRAKVDAGAAVHVGD
HPKDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA