Protein Info for Psyr_0168 in Pseudomonas syringae pv. syringae B728a

Annotation: Phosphoenolpyruvate carboxykinase (ATP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR00224: phosphoenolpyruvate carboxykinase (ATP)" amino acids 6 to 514 (509 residues), 616.8 bits, see alignment E=2e-189 PF01293: PEPCK_ATP" amino acids 7 to 468 (462 residues), 644.4 bits, see alignment E=5e-198

Best Hits

Swiss-Prot: 100% identical to PCKA_PSEU2: Phosphoenolpyruvate carboxykinase (ATP) (pckA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01610, phosphoenolpyruvate carboxykinase (ATP) [EC: 4.1.1.49] (inferred from 100% identity to psb:Psyr_0168)

Predicted SEED Role

"Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP or Serine-glyoxylate cycle (EC 4.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500D1 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Psyr_0168 Phosphoenolpyruvate carboxykinase (ATP) (Pseudomonas syringae pv. syringae B728a)
MTQTNNAVYTDLSTDELVKEALARKEGVLSDTGALVVETGHRTGRSPVDRFIVEEPSTQD
AIAWGPINRKFPAEKFDALWNRVGAYLAERERFVSHVHVGSDPAHYLPVKMTTETAWHNL
FGRCLFINPEQYNPAGKDEWEIQNAPWFVCDPERDGTNSDGTVIINFAARKVLIAGMRYA
GEMKKAMFSVQNFLLPASDVLPMHCAANMGEEGDVTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIQHGAVLENVVLDPVTKKADYADSS
LTQNSRAAYPRELIEKRAPKNLGGEPNAVIFLTCDLTGVLPPVSILSEEQAAYHFLSGYT
ALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLIKRIRGFKSKVYLVNTGWTGGG
YGVGKRFNIPTTRGVIAAIQSGALIGAETEHLDTINLDVPKSVPGVDTGLLNPRNTWADK
AAYDEAAKALAGLFVENFKKFDVSDAIKAAGPKL