Protein Info for Psyr_0131 in Pseudomonas syringae pv. syringae B728a

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3:HAD-superfamily hydrolase, subfamily IA, variant 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00702: Hydrolase" amino acids 7 to 180 (174 residues), 97.3 bits, see alignment E=3.1e-31 PF12710: HAD" amino acids 8 to 179 (172 residues), 30.5 bits, see alignment E=9.9e-11 PF13419: HAD_2" amino acids 8 to 182 (175 residues), 82.6 bits, see alignment E=7.3e-27 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 71 to 181 (111 residues), 45.3 bits, see alignment E=1.2e-15 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 75 to 187 (113 residues), 36.8 bits, see alignment E=4.3e-13 PF13242: Hydrolase_like" amino acids 143 to 201 (59 residues), 39.3 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0131)

Predicted SEED Role

"HAD-superfamily hydrolase, subfamily IA, variant 3:HAD-superfamily hydrolase, subfamily IA, variant 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500G8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psyr_0131 HAD-superfamily hydrolase, subfamily IA, variant 3:HAD-superfamily hydrolase, subfamily IA, variant 1 (Pseudomonas syringae pv. syringae B728a)
MRPQTSFIFDLDGTLTDSVYQNVAAWKEALDAEDIPLAMWRIHRKIGMSGGLMLKSLSRE
TGVNISEAQAERLSEKHAQAYERLQGQIIALPGAVELLETLDKENLKWCIATSGGIDTAT
INLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKINAPIDECLVIGDAIWDMLAARR
CKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIASRP