Protein Info for Psyr_0081 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 243 (241 residues), 393.6 bits, see alignment E=1.6e-122 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 137.1 bits, see alignment E=1.2e-43 PF08402: TOBE_2" amino acids 254 to 316 (63 residues), 24.2 bits, see alignment E=6.1e-09 PF12857: TOBE_3" amino acids 266 to 321 (56 residues), 45.4 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 99% identical to CYSA_PSESM: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to psb:Psyr_0081)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500L7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psyr_0081 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MSIEVRNVSKNFNAFKALNNISLDIQSGELVALLGPSGCGKTTLLRIIAGLETPDDGSIV
FHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPKRERPNETRIAEKVHEL
LNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLA
RLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPGEVYENPSNDFVYHFLGDS
NRLSLGAEGHLLFRPHEVSLSRQEIEDHHAAEVRDIRPLGATTRVTLKVEGQDELIEAEV
VKDHDSLVGLAKGETLFFKPKVWQKL