Protein Info for Psyr_0069 in Pseudomonas syringae pv. syringae B728a

Annotation: Na+/Pi-cotransporter:Na/Pi cotransporter II-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 46 to 69 (24 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 307 (307 residues), 340 bits, see alignment E=1.7e-105 PF02690: Na_Pi_cotrans" amino acids 13 to 147 (135 residues), 123.1 bits, see alignment E=8.7e-40 amino acids 160 to 244 (85 residues), 29.4 bits, see alignment E=7.5e-11 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 67 to 521 (455 residues), 349.5 bits, see alignment E=3.1e-108 PF01895: PhoU" amino acids 340 to 424 (85 residues), 29.9 bits, see alignment E=6e-11

Best Hits

Swiss-Prot: 64% identical to YJBB_ECO57: Uncharacterized protein YjbB (yjbB) from Escherichia coli O157:H7

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 100% identity to psb:Psyr_0069)

MetaCyc: 64% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500M9 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Psyr_0069 Na+/Pi-cotransporter:Na/Pi cotransporter II-related protein (Pseudomonas syringae pv. syringae B728a)
MLTLLDLLSAVALLIWGTHIVRTGILRVYGTQLRRVLSQNMSKRPLAFIAGILVTALVQS
SNATAMLVTSFVGQGLMTLTPALVIMLGADVGTALMSRVLTFDLSWLSPLLIFLGVVFFL
SRKQTRAGQLGRVGIGLGLIVLALQLIVEAAAPITQAAGVKVLFASLTGDLLLDALVGAM
FALISYSSLAAVLLTATLAGTEVIGLPVAIGLVIGANIGSGLLAFLSTSMQNVAGRQVAL
GSLLYKLFGLLLIFPVLDPLVAWIDTLGFSPQELVIGFHLLYNTVRCLIMLPTVAPMARL
CSYLLPQQNEVGGLAKPRHLDLTALSTPSLALANAVRETLRMGDLIESMLASMLAVLRGT
QTAVTQEVRRLNDDVEALYSAIKLYLAQMPREDLGEHDNRRWAEIIELTINLELASGLIE
RMLRKIQQQKTAHRRSFSEVGLEELADLQIQLQSNLRLGLSVFLSGDHESARQLLREKRQ
FRAEERRLAHAHVSRLRNKVVQSIETSSLHLELIADMKRLNSLFCSSAYVVLETADTGAL
SSEVEADRSL