Protein Info for Psyr_0064 in Pseudomonas syringae pv. syringae B728a

Annotation: Sensory transduction protein kinase AlgZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 83 (26 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details PF06580: His_kinase" amino acids 162 to 240 (79 residues), 83.3 bits, see alignment E=5.9e-28

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_0064)

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500N4 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Psyr_0064 Sensory transduction protein kinase AlgZ (Pseudomonas syringae pv. syringae B728a)
MRIEPVKHDARPAPGKDFFLPELCLPQALLVLVVLAELLVLVLVLVEPMRSGFDWVRLAL
MSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTLLCTAVTDVCQLTGRIS
VSGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRARIESLQARIRPHFLFNTL
NSIASLVASNPVKAEQAVLDLSDLFRASLAKPGSLVTWGEELALAKRYLSIEQYRLGERL
QLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRVEGGVVTVEANYEGGEFILSVSNPY
EEVANRQTSNGTQQALTNIGARIAALFGPHASLSVERRDGRHYTCLRYPCARLTQEARAI