Protein Info for Psyr_0059 in Pseudomonas syringae pv. syringae B728a

Annotation: HemY, N-terminal:HemY, N-terminal:HemY, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 43 to 73 (31 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 5 to 394 (390 residues), 376.4 bits, see alignment E=6.9e-117 PF07219: HemY_N" amino acids 27 to 133 (107 residues), 104.3 bits, see alignment E=5.5e-34

Best Hits

KEGG orthology group: K02498, HemY protein (inferred from 100% identity to psb:Psyr_0059)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500N9 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Psyr_0059 HemY, N-terminal:HemY, N-terminal:HemY, N-terminal (Pseudomonas syringae pv. syringae B728a)
MKRFYVLLFIAIAAAALIGVAIAEHSGYVLIAYQNFRYESSLWATLALLVVALLVIALLR
LLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSAQRHLQRAAEADTHPLL
YYIGAARAANEQGRYEDCDALLERALERQPQAELAIALNHAQLQQDRGDTEGALTTLLAM
KERHPHNPQVLRQLQRLYQQRGDWSDVVRLMPELRKDKVLPAKELAELERRAWGENLSLA
AYREGIEGAPTGLPSLESAWQGLGSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRSALKR
EYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKARDYLE
SSLRLERNPETCAELARLLGQLGETDRSNQLFQEGLGLLDERLLSRPLPVLTKA