Protein Info for Psyr_0054 in Pseudomonas syringae pv. syringae B728a

Annotation: alginate regulatory protein AlgR3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 62% identical to ALGP_PSEAE: Transcriptional regulatory protein AlgP (algP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0054)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

See Q500P4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Psyr_0054 alginate regulatory protein AlgR3 (Pseudomonas syringae pv. syringae B728a)
MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLEKQRGKAQEKLHNSRI
KLQDAATAGKSKAQAKAKGAVSELEELLDALKDRQTETRTYILHLKRDAQESLKLAQGIG
RVKEAVGKILTTRDAKPVAPKAVAKTPAAKAPAKTAAKAPVKTAAAKPVAKAAAKPSAAA
KPAAKTAVAKAPVKAAAKPAPRATAAAKPVAAKTTAAKPAAARTTAAKPAAAKPAATKAP
VAKTTASNAAKPAAAKAAAAKAPVKAPVKAPAKAPAKAPVKAAAKPVAKPAAKPAVKPAA
AKPATPAPAAAKPTTPAPAAPAAAPATPANGATPTSAS