Protein Info for Psyr_0010 in Pseudomonas syringae pv. syringae B728a
Annotation: D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to GMHBB_PSEPK: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to psb:Psyr_0010)Predicted SEED Role
"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- L-histidine biosynthesis (10/10 steps found)
KEGG Metabolic Maps
- 2,4-Dichlorobenzoate degradation
- Alkaloid biosynthesis II
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Biosynthesis of alkaloids derived from histidine and purine
- Ether lipid metabolism
- Fructose and mannose metabolism
- Glycerophospholipid metabolism
- Histidine metabolism
- Lipopolysaccharide biosynthesis
- Nicotinate and nicotinamide metabolism
- Retinol metabolism
- Riboflavin metabolism
- Sphingolipid metabolism
- Thiamine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.-
Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q500T8 at UniProt or InterPro
Protein Sequence (180 amino acids)
>Psyr_0010 D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase (Pseudomonas syringae pv. syringae B728a) MKLLILDRDGVINHDSDTYIKSVAEWLPIPGSIEAIAALSKAGWTVAVATNQSGIARGYY DLATLDAMHVRLRKLVAEQGGELGLIVYCPHGPDDGCTCRKPKPGMLRAIARHYAADLKG LWFVGDSKGDLQAALAVDSQPVLVMTGKGRKTMEGGVPAGTLIFDDLAAVAAELIHNSTH