Protein Info for Pf6N2E2_985 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug resistance transporter, Bcr/CflA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 138 to 154 (17 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 1 to 362 (362 residues), 216.9 bits, see alignment E=3.1e-68 PF07690: MFS_1" amino acids 4 to 328 (325 residues), 131.9 bits, see alignment E=4.1e-42 PF00083: Sugar_tr" amino acids 22 to 91 (70 residues), 38.5 bits, see alignment E=1.1e-13 PF06609: TRI12" amino acids 26 to 253 (228 residues), 35.6 bits, see alignment E=5.8e-13

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 35% identity to spe:Spro_1190)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWG7 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Pf6N2E2_985 Multidrug resistance transporter, Bcr/CflA family (Pseudomonas fluorescens FW300-N2E2)
MGLPAIADISHALGVSLAFASQTLSVFIFGFVLGPLLFGPLSDRIGRRPILLAGLVVFTI
AGIACTFAQDINLLLSARFLQGCAAGAAATLPIAIVRDQFEGVQARKLQSHLALVNNLAP
LIAPLLGSAILVVGNWRWIYAALAVCGVILWLRAQTSFDETATRKSSNAAASLLTSYLSV
LKSRRFLVSTLIMAFNFAGMFAYIAASPLVFMNNLGMTSAGFAVLFALTAMGTIAGSWVN
GRLIHAGFAEHRVLGGALLASLLISLGLVVESQLAIYPIYILTALVVMSNLCTGIVMPNA
THSALEDLSITAGAGAALLRATQMLGGACASLLAGAFYDGQTSHAMAGVMLACAVLGALT
FLIGHRSVKPHPVGEQAG