Protein Info for Pf6N2E2_96 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG011065: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 60 (18 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 137 to 165 (29 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 246 (239 residues), 156.4 bits, see alignment E=5.2e-50

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 97% identity to pba:PSEBR_a3774)

Predicted SEED Role

"FIG011065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJ16 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf6N2E2_96 FIG011065: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MFDIVLLCVFAFAAGLIDAAVGGGGLIQIPALFNVLPGAQPAALLGTNKVAAACGTAFAA
RSFVRKVVIDWSLVVPAAGAAFVMAFAGAATVSLVPQAVMRPAVLVLIMLMAIYTFWKKD
FGSLHKPMRIGTKEKLLAVLVGGAIGFYDGLFGPGTGSFLIFLFIRCFAFDFLHASASAK
LVNIATNVAALLFFIPSGNVLYLVALPMALFNILGALTGTWLAVRKGVPFVRALFLVLLV
ILISKLSYDLISVG