Protein Info for Pf6N2E2_85 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG045511: hypothetical antitoxin (to FIG022160: hypothetical toxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF21716: dnstrm_HI1420" amino acids 5 to 92 (88 residues), 137 bits, see alignment E=8.2e-45 TIGR02684: probable addiction module antidote protein" amino acids 5 to 91 (87 residues), 118.4 bits, see alignment E=6e-39

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_2007)

Predicted SEED Role

"FIG045511: hypothetical antitoxin (to FIG022160: hypothetical toxin)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YIM9 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Pf6N2E2_85 FIG045511: hypothetical antitoxin (to FIG022160: hypothetical toxin) (Pseudomonas fluorescens FW300-N2E2)
MSQHLTTFDMAALLDSDEATSEYLSQVLADGDSEEFLRAIGYVAKARGMAQIAKDSGMGR
ESLYKAFAPGSKPRFDTVLKVIHALGIDLHAQPGRAANHSPA