Protein Info for Pf6N2E2_823 in Pseudomonas fluorescens FW300-N2E2

Annotation: Outer membrane protein OprN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 11 to 464 (454 residues), 359 bits, see alignment E=2e-111 PF02321: OEP" amino acids 65 to 253 (189 residues), 64.9 bits, see alignment E=4.6e-22 amino acids 283 to 462 (180 residues), 75.7 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3074)

Predicted SEED Role

"Outer membrane protein OprN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YWU5 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Pf6N2E2_823 Outer membrane protein OprN (Pseudomonas fluorescens FW300-N2E2)
MSLKAFVPSLLVLALSACAVGPDYKAPQTEAANITTATDGAAGQKNFDRARFEGIWWQQF
DDPTLNALVTRSLEGNRELRVAFARLRAARAIRDDASNDAMPTITSRASSDLGKGQIPGQ
TTDRVNTERYDLGLDMAWELDLFGRIRRNLEATDADQQAVEADLYQLQVTMIAELVDAYG
QLRGAQLREKIALANLKNQQDSRKITESLRDAGVGDQLDVVRADARLASVEASVPQLQAE
QVRQRNRIATLLGERPDKLSVDLSPKQLPAIAKALPIGDPGELLQRRPDILSAERQLAAA
TARIGVAKADLFPRVSLSGFLGFTAGRGSQIGSSAANAWALGPSITWAAFDLGSVRARLR
GADAEADGALATYEQQVLLALEESENAFSDYGKRQQRLISLIRQSESSRAAADLAEIRYR
EGTVDFLVLLDAQRERLAAEDTQAQAEVDLYRGIVAIYKALGGGWKPETVASN