Protein Info for Pf6N2E2_821 in Pseudomonas fluorescens FW300-N2E2

Annotation: KaiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF13481: AAA_25" amino acids 13 to 148 (136 residues), 27.5 bits, see alignment E=1.4e-09 PF06745: ATPase" amino acids 13 to 239 (227 residues), 140.9 bits, see alignment E=2.6e-44 amino acids 255 to 473 (219 residues), 106.4 bits, see alignment E=9.3e-34

Best Hits

KEGG orthology group: K08482, circadian clock protein KaiC (inferred from 99% identity to pba:PSEBR_a3076)

Predicted SEED Role

"KaiC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSE4 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Pf6N2E2_821 KaiC (Pseudomonas fluorescens FW300-N2E2)
LSTSNELISAKAATGIEGLDDVLSGGLSRGHVFLLEGEPGTGKTTVALHFLLAGAKAGER
SLYITLSETERELRQGATSHGWTLDDNIHIFELTPPESLLNAEHQQSLLYSSDLELGEAT
RQIFEVVERVKPTRVVLDSLSEIRLLAQSSLRYRRQILAIKHYFVRYDATVLLLDDLTTE
SLDKTVHSVAHGVIRLEELTPNYGAERRRIRVVKYRGQKYRGGYHDFTIMGDGVHVFPRL
VAAEHRGQYLRQQLSSGIGEMDALLGGGIETGSSTLILGPAGTGKSLIAMIFAAAAVHRG
EKAALFIFDEELGLLFERMKNIGIDLQALQETGNLLIEQVDAAELSPGEFSHRVRRCVDE
GDIKTVVIDSINGYQAAMPEENALVLHMHELLLYLNRKGAATFMTVAQHGLVGDMQAPVD
ITYLADTVILLRYFEALGKVRRAISIIKKRTGSHESTIREYRISGLGMTIGEPLEAFQGV
LRGVPTYMGESNPLLRDEHR