Protein Info for Pf6N2E2_817 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein-glutamate methylesterase (EC 3.1.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF01339: CheB_methylest" amino acids 15 to 190 (176 residues), 182.9 bits, see alignment E=2.4e-58

Best Hits

Swiss-Prot: 43% identical to CHEB2_LEPIN: Putative protein-glutamate methylesterase/protein-glutamine glutaminase (cheB2) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 97% identity to pba:PSEBR_a3080)

Predicted SEED Role

"Protein-glutamate methylesterase (EC 3.1.1.61)" (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUU9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Pf6N2E2_817 Protein-glutamate methylesterase (EC 3.1.1.61) (Pseudomonas fluorescens FW300-N2E2)
MNQTKDRSNPPIEAVVVGASAGGVDALLKVFGHLRKGFGVPILVVLHLPDERESQLARVF
GHRLAVPVEEARDKQDIVPGTLYVATPGYHLSVEADRSLSLSLEEPLHHSRPSIDVLFES
AADVYGQKLLAVVLTGANNDGACGLAKVRALGGITVVQDPNEAQVSTMPEAALALHEPDH
ILTLQGIGQLLAGLE