Protein Info for Pf6N2E2_80 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): gamma-glutamylputrescine oxidase (EC 1.4.3.-)
Rationale: Specifically important for: Putrescine Dihydrochloride. This is part of the gamma-glutamyl-putrescine pathway. (KEGG_correct)
Original annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 1 to 348 (348 residues), 227.9 bits, E=2.7e-71
• PF13450: NAD_binding_8
  • amino acids 1 to 30 (30 residues), 22.2 bits, see alignment (E = 1.4e-08)

Best Hits

Swiss-Prot: 67% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 99% identity to pba:PSEBR_a3852)

MetaCyc: 67% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of ornithine degradation (7/8 steps found)
• putrescine degradation II (4/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

See A0A165YII0 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Pf6N2E2_80 gamma-glutamylputrescine oxidase (EC 1.4.3.-) (Pseudomonas fluorescens FW300-N2E2)
VIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGASGRNGGQIVNSYSRDIDVIERSVGPQ
QAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGGVFAALTAKQMGHLESQKRLWERFGHTQ
LELLDQRRIREVVACEEYVGGMLDMSGGHIHPLNLALGEAAAVESLGGVIYEQSPAVRIE
RGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPELAAKSMPCGTQVIATEPLGDELAHSLL
PQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVYGARDPANIEAIIRPKMLKAFPQLKDVKI
DYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCSGHGVTYTHLAGKVLAEALRGQAERFDAF
ADLPHYPFPGGQLLRTPFAAMGAWYYGLRDKLGF