Protein Info for Pf6N2E2_78 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 14 to 194 (181 residues), 151.7 bits, see alignment E=3.6e-48 PF08659: KR" amino acids 16 to 171 (156 residues), 32.8 bits, see alignment E=1.3e-11 PF13561: adh_short_C2" amino acids 20 to 251 (232 residues), 224.2 bits, see alignment E=3.7e-70 PF23441: SDR" amino acids 64 to 250 (187 residues), 42.1 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 77% identical to Y3106_PSEAE: Uncharacterized oxidoreductase PA3106 (PA3106) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3853)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YIG5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Pf6N2E2_78 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas fluorescens FW300-N2E2)
VIELATPPSGTHGRVALVTGAARGIGLGIAAWLICEGWQVVLTDLDRERGSKVAKTLGDN
AWFIAMDVADEAQVATGIAEVLGQFGRLDALVCNAAIADPHNITLESLDLAYWNRVLAVN
LGGPMLLAKHCAPYLRAHNGAIVNLASTRAAQSEPDTEAYAASKGGLLALTHALAISLGP
EIRVNAVSPGWIDARDPSQRRAQPLTDADHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVT
GQEFVVDGGMTKKMIYE