Protein Info for Pf6N2E2_757 in Pseudomonas fluorescens FW300-N2E2

Annotation: 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 325 (325 residues), 399.2 bits, see alignment E=5.5e-124 PF03807: F420_oxidored" amino acids 3 to 49 (47 residues), 23.3 bits, see alignment 1.7e-08 PF03446: NAD_binding_2" amino acids 3 to 153 (151 residues), 132.3 bits, see alignment E=3.4e-42 PF02254: TrkA_N" amino acids 5 to 47 (43 residues), 23.4 bits, see alignment 1.3e-08 PF00393: 6PGD" amino acids 185 to 303 (119 residues), 79.1 bits, see alignment E=7.8e-26

Best Hits

Swiss-Prot: 64% identical to 6PGDH_GLUOX: 6-phosphogluconate dehydrogenase, NAD(+)-dependent, decarboxylating (GOX1705) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 99% identity to pba:PSEBR_a3123)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZS99 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Pf6N2E2_757 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) (Pseudomonas fluorescens FW300-N2E2)
MQLGIIGLGRMGGNIARRLMLNGHTTVVYDRNAAFVENLRQDGATGVADLPALVAGLEKP
RAVWVMLPAGAPTEDTINVLSELLEPGDVIIDGGNTYYKDDIRRAQALSEKGLSYIDVGT
SGGVWGLERGYCMMIGGDAEVVKRLDPLFDSLAPGMGDIPRTRDRKSDDDRAERGYIHAG
PAGSGHFVKMIHNGIEYGMMQAFAEGFDILKTKSSESLPAEQRFDLNLADIAEVWRRGSV
VSSWLLDLTADALASDPKLDGFSGEVADSGEGRWTIEAAIEQAVPVPVLSSSLFARFRSR
QQSTYGDKMLSAMRFGFGGHVETPKK