Protein Info for Pf6N2E2_691 in Pseudomonas fluorescens FW300-N2E2

Annotation: D-galactarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 317 to 333 (17 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 391 (362 residues), 154.5 bits, see alignment E=1.9e-49

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3184)

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YVW9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Pf6N2E2_691 D-galactarate permease (Pseudomonas fluorescens FW300-N2E2)
LNNVTDSTHDSTLALAAAKVKRHVLPLVVVMFIVNYIDRVNIGFVRSHLETDLGIGAAAY
GLGAGLFFVGYALFEVPSNMLLQRYGARAWLTRIMFTWGAAAMAMAFVRGETSFYVLRFI
LGAAEAGFFPGIIYYFTQWLPANERGKAMAIFLSGSAIASVISGPVSGALLHISGMGLHG
WQWMFLIEGFASIVLCGFVWFWLQSHPSQAKWLSSEEKTVLIAAIAEEQRAREAAQVIKP
SIFKLLADRQIALFCFIYFSIALTIYGATFWLPSMIKKMGNLGDFQVGLLNSIPWIISII
AMYGFAALAGKWKFQQAWVAVTLVVAAFGMFMSTTGGPIFAFVAICFAAIGFKAASALFW
PIPQGYLDARIAAAVIALINSIGNLGGFVAPTAFGFLEQTTGSIEGGLYGLAATSLVAAV
VIFFARTAPKRDTPNSLSGRPEAVAEASQSQTSQALKPGPSGAAV