Protein Info for Pf6N2E2_678 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 6 to 291 (286 residues), 101.7 bits, see alignment E=1.6e-32 PF01134: GIDA" amino acids 6 to 78 (73 residues), 24.1 bits, see alignment E=5.5e-09 PF00890: FAD_binding_2" amino acids 6 to 41 (36 residues), 26.7 bits, see alignment 1e-09 PF12831: FAD_oxidored" amino acids 6 to 45 (40 residues), 37.4 bits, see alignment 5.9e-13 PF13450: NAD_binding_8" amino acids 9 to 43 (35 residues), 26.5 bits, see alignment 2e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3199)

MetaCyc: 67% identical to D-hydroxyproline dehydrogenase alpha subunit (Pseudomonas aeruginosa PAO1)
1.14.19.-

Predicted SEED Role

"Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUK0 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Pf6N2E2_678 Putative oxidoreductase in 4-hydroxyproline catabolic gene cluster (Pseudomonas fluorescens FW300-N2E2)
MNETTDLLIIGAGPAGMAAALAAASSGARIVLLDDNPLPGGQIWRDGPQANLHSAARRLR
EQLQTCANVRCHAGTRVIACAADKTLLVEDAERGWQISYERLILCTGARERLLPFPGWTL
PGVTGAGGLQALIKGGLPVRGERLVIAGSGPLLLASAATAKHQGAQVLRIAEQARRGAVA
GFAAQLPRWPGKFFQSFSLFDRHYRTDTHVVEALGRERLEGVRLYQQGKTIELACDRLAC
GFGLIPNTQLGQALGCAVEDQALAVDAWQATTRHEHYAAGECTGFGGSELALVEGAIAGH
AAVGNSAAAQQLWPRRARWQSFAGALNQAFVLDPRLKALARSDTLVCRCEDVPYGELVGH
ENWREAKLASRCGMGACQGRVCGAALEHLFGWTPPAPRPPFSPARIETLLALEETPPT