Protein Info for Pf6N2E2_671 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-methylaconitate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF05544: Pro_racemase" amino acids 9 to 334 (326 residues), 466.8 bits, see alignment E=1.8e-144

Best Hits

Swiss-Prot: 83% identical to T3HPD_PSEAE: Probable trans-3-hydroxy-L-proline dehydratase (PA1255) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3206)

Predicted SEED Role

"2-methylaconitate racemase" in subsystem 2-methylcitrate to 2-methylaconitate metabolism cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTH2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Pf6N2E2_671 2-methylaconitate racemase (Pseudomonas fluorescens FW300-N2E2)
MRSSKIIHVVSCHAEGEVGDVIVGGVAPPPGATVWEQSRWIAQDQTLRNFVLNEPRGGVF
RHVNLLVPAKDPRAQMAWIIMEPADTPPMSGSNSLCVATVLLDSGILPMTEPQTRLVLEA
PGGLIEAVADCRDGKVQRVEIKNVPSFADRLDAWIEVEGLGSLQVDTAYGGDSFVIVDAQ
RLGFAIRPDEAAELVAVGLKITRAANEQLGFVHPLNPDWSHISFCQIAAPIVQENGIATG
ANAVVIQPGKIDRSPTGTGCSARMAVLHAKGLMQVGERFIGRSIIGSEFHCRIDSLTDVA
GRPAIYPCIAGRAWITGTHQLLLDPADPWPQGYRLSDTWPGA