Protein Info for Pf6N2E2_663 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional activator of acetoin dehydrogenase operon AcoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 PF01590: GAF" amino acids 77 to 204 (128 residues), 40 bits, see alignment E=1.4e-13 PF00158: Sigma54_activat" amino acids 319 to 477 (159 residues), 219.8 bits, see alignment E=4.6e-69 PF14532: Sigma54_activ_2" amino acids 331 to 486 (156 residues), 85.6 bits, see alignment E=9.6e-28 PF07728: AAA_5" amino acids 337 to 438 (102 residues), 22.2 bits, see alignment E=3.2e-08 PF02954: HTH_8" amino acids 575 to 607 (33 residues), 33.3 bits, see alignment (E = 8.1e-12)

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3214)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZRN3 at UniProt or InterPro

Protein Sequence (621 amino acids)

>Pf6N2E2_663 Transcriptional activator of acetoin dehydrogenase operon AcoR (Pseudomonas fluorescens FW300-N2E2)
MLSAHSRAHVDCVSRVVKNANQLPQLPVPDLILDSWRRSLEQHHLDPGSLQGPRILSQDV
LKQCRERSELFLNIASEEVARLHGRVRDADYCVLLTDAQGQTIDYRVETTIRNDCRKAGL
YLGTCWSEGEEGTCGVAAVLTAKAPVTVHKRDHFRAAFIGLTCSAAPVFDPQGELLGVLD
VSAVRSPDDRRSQHLIRQMVVQSAREIEQAFFMSSAQGYWVLRAHRNAGYVDSQPDFLFA
WDDDGCLQALNPAARQYLLQHYGQLPQHIGQVFDQQLLHRARDESLCSLDHAMHGRLSAP
RQRASSRSRVAVTPLEIDPRLADSLRLAVRVKDRNLPVLIQGETGSGKEVFARQLHQASQ
RRDRPFVALNCAAIPESLIESELFGYVAGAFTGASAKGMQGLLQQADGGTLFLDEIGDMP
LALQTRLLRVLAEGEVAPLGASRRKAVDIQVICATHRDLETLVAAGEFREDLYFRLGGAR
FQLPPLRERSDRLALINRILAEESALCGATVQLSGAALECLLGYHWPGNVRQLRHVLRYA
CAVCEASVVQLSHLPESMHHTDAADHGPEPSASPERQALLDALVRHRWKPTAAARALGIS
RATLYRRVNLHGIEMPGRSPA